PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002727G0080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family CO-like
Protein Properties Length: 296aa    MW: 31670.7 Da    PI: 5.4268
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002727G0080genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.32.4e-06143541
         zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                     +C+ +e  ++   C+ +   lC++C   +H        H +vp
  PH01002727G0080  1 MCEVCELAPAAVTCKADAAVLCATCDADIHDAnplarrHVRVP 43
                     5*****************************4467777788777 PP

2CCT69.58.4e-24222265144
              CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                      Rea+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k+a
  PH01002727G0080 222 REARLMRYREKRKNRRFEKTIRYASRKAYAEKRPRIKGRFAKRA 265
                      9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.4E-9144IPR000315B-box-type zinc finger
CDDcd000215.17E-8144No hitNo description
PROSITE profilePS5011910.296144IPR000315B-box-type zinc finger
PROSITE profilePS5101716.916222264IPR010402CCT domain
PfamPF062031.5E-17222264IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MCEVCELAPA AVTCKADAAV LCATCDADIH DANPLARRHV RVPVAPIGSA AAEAMLIGTG  60
EPEPEEKANP AAAVEHQQHA LNLNVEAKDL KLDYLFSDLD PYLNVEFARF PHADSVVPNG  120
AGVGAVVELD FTCGLGAKPS YSSYTATSLA HSGSSSEVGV VPEAICGGGG SIELDFTRPK  180
PQAYMSYTAT PPSHSLSSVD VGVVPERGEG AVVRAAAMGE DREARLMRYR EKRKNRRFEK  240
TIRYASRKAY AEKRPRIKGR FAKRADHDAE DAEVEAEAAV PSSYMLDFGY GVVPTF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0985790.0FP098579.1 Phyllostachys edulis cDNA clone: bphylf061d21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641209.11e-140PREDICTED: zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A0E0LE711e-147A0A0E0LE71_ORYPU; Uncharacterized protein
STRINGLOC_Os06g44450.11e-140(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.12e-46CONSTANS-like 5